Euro
British Pound
US Dollar
Product Description
Recombinant Human Scrapie-responsive protein 1 (SCRG1) is available at Gentaur for Next week Delivery.
Gene Name: SCRG1
Alternative Names : Scrapie-responsive gene 1 protein;ScRG-1
Expression Region : 21-98aa
AA Sequence : MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 10.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Secreted
Protein Families : SCRG1 family
Tissue Specificity : Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.
Paythway :
Uniprot ID : O75711
