Euro
British Pound
US Dollar
Product Description
Recombinant Human Serine/arginine-rich splicing factor 10 (SRSF10) is available at Gentaur for Next week Delivery.
Gene Name: SRSF10
Alternative Names : 40KDA SR-repressor protein;SRrp40FUS-interacting serine-arginine-rich protein 1Splicing factor SRp38Splicing factor, arginine/serine-rich 13ATLS-associated protein with Ser-Arg repeats;TASR;TLS-associated protein with SR repeatsTLS-associated serine-arginine protein;TLS-associated SR protein
Expression Region : 1-183aa
AA Sequence : MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
Sequence Info : Full Length of Isoform 3
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 38.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
Function : Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing
Involvement in disease :
Subcellular location : Nucleus speckle, Cytoplasm
Protein Families : Splicing factor SR family
Tissue Specificity : Widely expressed.
Paythway :
Uniprot ID : O75494
