Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9)

Product Description

Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9) is available at Gentaur for Next week Delivery.

Gene Name: SRSF9

Alternative Names : Pre-mRNA-splicing factor SRp30CSplicing factor, arginine/serine-rich 9

Expression Region : 1-221aa

AA Sequence : MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 52.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10

Function : Plays a role in constitutive splicing and can modulate the selection of alternative splice sites. Represses the splicing of MAPT/Tau exon 10.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Splicing factor SR family

Tissue Specificity : Expressed at high levels in the heart, kidney, pancreas and placenta, and at lower levels in the brain, liver, lung and skeletal muscle.

Paythway :

Uniprot ID : Q13242