Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta (PPP2R3B)

Product Description

Recombinant Human Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta (PPP2R3B) is available at Gentaur for Next week Delivery.

Gene Name: PPP2R3B

Alternative Names : PP2A subunit B isoform PR48Protein phosphatase 2A 48KDA regulatory subunit

Expression Region : 1-176aa

AA Sequence : MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPFQDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFDTFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEKYAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLSALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEPL

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Function : The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.

Involvement in disease :

Subcellular location : Nucleus

Protein Families :

Tissue Specificity :

Paythway : PI3K-Aktsignalingpathway

Uniprot ID : Q9Y5P8