Product Description
Recombinant Human Serpin B9 (SERPINB9) is available at Gentaur for Next week Delivery.
Gene Name: SERPINB9
Alternative Names : Cytoplasmic antiproteinase 3
Expression Region : 1-376aa
AA Sequence : METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSSP
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 69.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Granzyme B inhibitor.
Function : Granzyme B inhibitor.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Serpin family, Ov-serpin subfamily
Tissue Specificity :
Paythway :
Uniprot ID : P50453
Euro
British Pound
US Dollar