Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein (SERS), partial

Product Description

Recombinant human Seryl-tRNA synthetase,Cytoplasmic domain protein (SERS), partial is available at Gentaur for Next week Delivery.

Gene Name: SERS

Alternative Names : Seryl-tRNA synthetase;SerRSSeryl-tRNA(Ser/Sec) synthetase

Expression Region : 2-233aa

AA Sequence : VLDLDLFRVDKGGDPALIRETQEKRFKDPGLVDQLVKADSEWRRCRFRADNLNKLKNLCSKTIGEKMKKKEPVGDDESVPENVLSFDDLTADALANLKVSQIKKVRLLIDEAILKCDAERIKLEAERFENLREIGNLLHPSVPISNDEDVDNKVERIWGDCTVRKKYSHVDLVVMVDGFEGEKGAVVAGSRGYFLKGVLVFLEQALIQYALRTLGSRGYIPIYTPFFMRKEV

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 53.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the attachment of serine to tRNA(Ser). Is also probably able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L-seryl-tRNA(Sec), which will be further converted into selenocysteinyl-tRNA(Sec).

Function : Catalyzes the attachment of serine to tRNA(Ser) in a two-step reaction

Involvement in disease : Neurodevelopmental disorder with microcephaly, ataxia, and seizures (NEDMAS)

Subcellular location : Cytoplasm, Nucleus

Protein Families : Class-II aminoacyl-tRNA synthetase family, Type-1 seryl-tRNA synthetase subfamily

Tissue Specificity : Brain.

Paythway :

Uniprot ID : P49591