Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial

Product Description

Recombinant Human Sialic acid-binding Ig-like lectin 15 (SIGLEC15), partial is available at Gentaur for Next week Delivery.

Gene Name: SIGLEC15

Alternative Names : CD33 antigen-like 3

Expression Region : 20-263aa

AA Sequence : FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 30.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Binds sialylated glycoproteins.

Function : Binds sialylated glycoproteins.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families : Immunoglobulin superfamily, SIGLEC (sialic acid binding Ig-like lectin) family

Tissue Specificity : Expressed in macrophage and/or dendritic cells of spleen and lymph nodes.

Paythway :

Uniprot ID : Q6ZMC9