Euro
British Pound
US Dollar
Product Description
Recombinant Human Signal transducer and activator of transcription 3 (STAT3), partial is available at Gentaur for Next week Delivery.
Gene Name: STAT3
Alternative Names : Acute-phase response factor
Expression Region : 50-240aa
AA Sequence : ESHATLVFHNLLGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 38.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF and other growth factors. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Binds to the interleukin-6 (IL-6)-responsive elents identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Cytoplasmic domain STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays an important role in host defense in methicillin-resistant S.aureus lung infection by regulating the expression of the antimicrobial lectin REG3G .
Function : Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors
Involvement in disease : Hyperimmunoglobulin E recurrent infection syndrome, autosomal dominant (AD-HIES); Autoimmune disease, multisystem, infantile-onset, 1 (ADMIO1)
Subcellular location : Cytoplasm, Nucleus
Protein Families : Transcription factor STAT family
Tissue Specificity : Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Paythway : Chemokinesignalingpathway
Uniprot ID : P40763
