Product Description
Recombinant Human Signal transducer CD24 (CD24) is available at Gentaur for Next week Delivery.
Gene Name: CD24
Alternative Names : Small cell lung carcinoma cluster 4 antigen; CD24
Expression Region : 27-80aa
AA Sequence : SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal GST-tagged
Theoretical MW : 32.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Modulates B-cell activation responses. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells.
Function : May have a pivotal role in cell differentiation of different cell types. Signaling could be triggered by the binding of a lectin-like ligand to the CD24 carbohydrates, and transduced by the release of second messengers derived from the GPI-anchor. Modulates B-cell activation responses. Promotes AG-dependent proliferation of B-cells, and prevents their terminal differentiation into antibody-forming cells
Involvement in disease : Multiple sclerosis (MS)
Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor
Protein Families : CD24 family
Tissue Specificity : B-cells. Expressed in a number of B-cell lines including P32/ISH and Namalwa. Expressed in erythroleukemia cell and small cell lung carcinoma cell lines. Also expressed on the surface of T-cells.
Paythway : Hematopoieticcelllineage
Uniprot ID : P25063
 Euro
            
 British Pound
            
 US Dollar