Recombinant Human Small proline-rich protein 3 (SPRR3)

Product Description

Recombinant Human Small proline-rich protein 3 (SPRR3) is available at Gentaur for Next week Delivery.

Gene Name: SPRR3

Alternative Names : 22KDA pancornulin Cornifin beta Esophagin

Expression Region : 2-169aa

AA Sequence : SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cross-linked envelope protein of keratinocytes.

Function : Cross-linked envelope protein of keratinocytes.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Cornifin (SPRR) family

Tissue Specificity :

Paythway :

Uniprot ID : Q9UBC9