Product Description
Recombinant Human Small proline-rich protein 3 (SPRR3) is available at Gentaur for Next week Delivery.
Gene Name: SPRR3
Alternative Names : 22KDA pancornulin Cornifin beta Esophagin
Expression Region : 2-169aa
AA Sequence : SSYQQKQTFTPPPQLQQQQVKQPSQPPPQEIFVPTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTKVPEPGYTKVPEPGSIKVPDQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQK
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 34 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cross-linked envelope protein of keratinocytes.
Function : Cross-linked envelope protein of keratinocytes.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Cornifin (SPRR) family
Tissue Specificity :
Paythway :
Uniprot ID : Q9UBC9
Euro
British Pound
US Dollar