Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial

Product Description

Recombinant Human Sodium-dependent phosphate transport protein 2B (SLC34A2), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC34A2

Alternative Names : Na(+)-dependent phosphate cotransporter 2BNaPi3bSodium/phosphate cotransporter 2B;Na(+)/Pi cotransporter 2B;NaPi-2bSolute carrier family 34 member 2

Expression Region : 574-689aa

AA Sequence : LLQSRCPRVLPKKLQNWNFLPLWMRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCDCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECTA

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in actively transporting phosphate into cells via Na+ cotransport. It may be the main phosphate transport protein in the intestinal brush border mbrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Function : May be involved in actively transporting phosphate into cells via Na(+) cotransport. It may be the main phosphate transport protein in the intestinal brush border membrane. May have a role in the synthesis of surfactant in lungs' alveoli.

Involvement in disease : Pulmonary alveolar microlithiasis (PALM)

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : SLC34A transporter family

Tissue Specificity : Highly expressed in lung. Also detected in pancreas, kidney, small intestine, ovary, testis, prostate and mammary gland. In lung, it is found in alveolar type II cells but not in bronchiolar epithelium.

Paythway :

Uniprot ID : O95436