Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial

Product Description

Recombinant Human Sodium/glucose cotransporter 2 (SLC5A2), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC5A2

Alternative Names : Low affinity sodium-glucose cotransporter Solute carrier family 5 member 2

Expression Region : 1-102aa

AA Sequence : MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGRSMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNA

Sequence Info : Partial

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 30.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Sodium-dependent glucose transporter. Has a Na+ to glucose coupling ratio of 1:1. Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na+/glucose cotransporter arranged in series along kidney proximal tubules.

Function : Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1

Involvement in disease : Renal glucosuria (GLYS)

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : Sodium:solute symporter (SSF) (TC 2.A.21) family

Tissue Specificity :

Paythway :

Uniprot ID : P31639