Recombinant Human Sorcin (SRI)

Product Description

Recombinant Human Sorcin (SRI) is available at Gentaur for Next week Delivery.

Gene Name: SRI

Alternative Names : 22KDA protein CP-22

Expression Region : 1-198aa

AA Sequence : MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 48.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.

Function : Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.

Involvement in disease :

Subcellular location : Cytoplasm, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families :

Tissue Specificity : Detected in cardiac myocytes.

Paythway :

Uniprot ID : P30626