Product Description
Recombinant Human Sorting nexin-20 (SNX20), partial is available at Gentaur for Next week Delivery.
Gene Name: SNX20
Alternative Names : Selectin ligand-interactor Cytoplasmic domain 1
Expression Region : 1-102aa
AA Sequence : MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 38.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Serves as a sorting protein that cycles P-selectin glycoprotein ligand 1 (PSLG1) into endosomes with no impact on leukocytes recruitment.
Function : May play a role in cellular vesicle trafficking. Has been proposed to function as a sorting protein that targets SELPLG into endosomes, but has no effect on SELPLG internalization from the cell surface, or on SELPLG-mediated cell-cell adhesion.
Involvement in disease :
Subcellular location : Early endosome membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Cytoplasm, Nucleus
Protein Families : Sorting nexin family
Tissue Specificity :
Paythway :
Uniprot ID : Q7Z614