Recombinant Human Sorting nexin-24 (SNX24)

Product Description

Recombinant Human Sorting nexin-24 (SNX24) is available at Gentaur for Next week Delivery.

Gene Name: SNX24

Alternative Names :

Expression Region : 1-169aa

AA Sequence : MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 35.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in several stages of intracellular trafficking.

Function : May be involved in several stages of intracellular trafficking.

Involvement in disease :

Subcellular location : Cytoplasmic vesicle membrane, Peripheral membrane protein, Cytoplasmic side

Protein Families : Sorting nexin family

Tissue Specificity :

Paythway :

Uniprot ID : Q9Y343