Recombinant Human Sperm-associated antigen 16 protein (SPAG16)

Product Description

Recombinant Human Sperm-associated antigen 16 protein (SPAG16) is available at Gentaur for Next week Delivery.

Gene Name: SPAG16

Alternative Names : Pf20 protein homolog

Expression Region : 1-183aa

AA Sequence : MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYVIF

Sequence Info : Full Length of Isoform 4

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.6 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia

Function : Necessary for sperm flagellar function. Plays a role in motile ciliogenesis. May help to recruit STK36 to the cilium or apical surface of the cell to initiate subsequent steps of construction of the central pair apparatus of motile cilia (By similarity).

Involvement in disease :

Subcellular location : Cytoplasm, Cytoplasm, cytoskeleton, flagellum axoneme, Cytoplasm, cytoskeleton, cilium axoneme

Protein Families :

Tissue Specificity : Isoform 1 is detected in testis. Isoform 4 is detected in testis and brain, and at lower levels in kidney, heart, pancreas, thyroid, ovary, adrenal gland, spinal cord, trachea and liver.

Paythway :

Uniprot ID : Q8N0X2