Product Description
Recombinant Human StAR-related lipid transfer protein 7, mitochondrial (STARD7), partial is available at Gentaur for Next week Delivery.
Gene Name: STARD7
Alternative Names : Gestational trophoblastic tumor protein 1START domain-containing protein 7;StARD7
Expression Region : 61-307aa
AA Sequence : LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 56.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : May play a protective role in mucosal tissues by preventing exaggerated allergic responses.
Involvement in disease :
Subcellular location : Mitochondrion
Protein Families :
Tissue Specificity : Expressed in nasal epithelial cells. Down-regulated in nasal epithelial cells in patients experiencing an asthma exacerbation as compared to stable asthmatics and healthy controls.
Paythway :
Uniprot ID : Q9NQZ5
Euro
British Pound
US Dollar