Recombinant Human StAR-related lipid transfer protein 7, mitochondrial (STARD7), partial

Product Description

Recombinant Human StAR-related lipid transfer protein 7, mitochondrial (STARD7), partial is available at Gentaur for Next week Delivery.

Gene Name: STARD7

Alternative Names : Gestational trophoblastic tumor protein 1START domain-containing protein 7;StARD7

Expression Region : 61-307aa

AA Sequence : LWRRLHGRPGHASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMV

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 56.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : May play a protective role in mucosal tissues by preventing exaggerated allergic responses.

Involvement in disease :

Subcellular location : Mitochondrion

Protein Families :

Tissue Specificity : Expressed in nasal epithelial cells. Down-regulated in nasal epithelial cells in patients experiencing an asthma exacerbation as compared to stable asthmatics and healthy controls.

Paythway :

Uniprot ID : Q9NQZ5