Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial

Product Description

Recombinant Human Store-opeRated calcium entry-associated regulatory factor (SARAF), partial is available at Gentaur for Next week Delivery.

Gene Name: SARAF

Alternative Names : HBV X-transactivated gene 3 protein HBV XAg-transactivated protein 3 Protein FOAP-7 Transmembrane protein 66

Expression Region : 195-339aa

AA Sequence : SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Biochemicals

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Negative regulator of store-operated Ca2+ entry (SOCE) involved in protecting cells from Ca2+ overfilling. In response to cytosolic Ca2+ elevation after endoplasmic reticulum Ca2+ refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca2+ levels, and thus preventing the overload of the cell with excessive Ca2+ ions.

Function : Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families : SARAF family

Tissue Specificity : Highly expressed in macrophages.

Paythway :

Uniprot ID : Q96BY9