Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial protein (SDHA), partial

Product Description

Recombinant Human Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial protein (SDHA), partial is available at Gentaur for Next week Delivery.

Gene Name: SDHA

Alternative Names : Flavoprotein subunit of complex II;Fp

Expression Region : 44-293aa

AA Sequence : SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 31.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.

Function : Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q)

Involvement in disease : Mitochondrial complex II deficiency (MT-C2D); Leigh syndrome (LS); Cardiomyopathy, dilated 1GG (CMD1GG); Paragangliomas 5 (PGL5)

Subcellular location : Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Protein Families : FAD-dependent oxidoreductase 2 family, FRD/SDH subfamily

Tissue Specificity :

Paythway : OxidativePhosphorylation

Uniprot ID : P31040