Recombinant Human Sulfotransferase 1A3/1A4 (SULT1A3)

Product Description

Recombinant Human Sulfotransferase 1A3/1A4 (SULT1A3) is available at Gentaur for Next week Delivery.

Gene Name: SULT1A3

Alternative Names : Aryl sulfotransferase 1A3/1A4 Catecholamine-sulfating phenol sulfotransferase HAST3 M-PST Monoamine-sulfating phenol sulfotransferase Placental estrogen sulfotransferase Sulfotransferase 1A3/1A4 Sulfotransferase, monoamine-preferring Thermolabile phenol sulfotransferase Short name: TL-PST

Expression Region : 1-295aa

AA Sequence : MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 50.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs

Function : Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of phenolic monoamines (neurotransmitters such as dopamine, norepinephrine and serotonin) and phenolic and catechol drugs.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Sulfotransferase 1 family

Tissue Specificity : Liver, colon, kidney, lung, brain, spleen, small intestine, placenta and leukocyte.

Paythway :

Uniprot ID : P0DMM9