Recombinant Human Synaptogyrin-1 (SYNGR1)

Product Description

Recombinant Human Synaptogyrin-1 (SYNGR1) is available at Gentaur for Next week Delivery.

Gene Name: SYNGR1

Alternative Names :

Expression Region : 1-191aa

AA Sequence : MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP

Sequence Info : Full Length of Isoform 1B

Tag Info : N-terminal GST-tagged

Theoretical MW : 48 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the regulation of short-term and long-term synaptic plasticity.

Function : May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).

Involvement in disease :

Subcellular location : Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Multi-pass membrane protein, Melanosome

Protein Families : Synaptogyrin family

Tissue Specificity :

Paythway :

Uniprot ID : O43759