Product Description
Recombinant Human Synaptogyrin-1 (SYNGR1) is available at Gentaur for Next week Delivery.
Gene Name: SYNGR1
Alternative Names :
Expression Region : 1-191aa
AA Sequence : MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP
Sequence Info : Full Length of Isoform 1B
Tag Info : N-terminal GST-tagged
Theoretical MW : 48 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in the regulation of short-term and long-term synaptic plasticity.
Function : May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity). Involved in the regulation of short-term and long-term synaptic plasticity (By similarity).
Involvement in disease :
Subcellular location : Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane, Multi-pass membrane protein, Melanosome
Protein Families : Synaptogyrin family
Tissue Specificity :
Paythway :
Uniprot ID : O43759
Euro
British Pound
US Dollar