Recombinant Human Synaptosomal-associated protein 29 (SNAP29)

Product Description

Recombinant Human Synaptosomal-associated protein 29 (SNAP29) is available at Gentaur for Next week Delivery.

Gene Name: SNAP29

Alternative Names : Soluble 29KDA NSF attachment protein Vesicle-membrane fusion protein SNAP-29

Expression Region : 1-258aa

AA Sequence : MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 56 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.

Function : SNAREs, soluble N-ethylmaleimide-sensitive factor-attachment protein receptors, are essential proteins for fusion of cellular membranes. SNAREs localized on opposing membranes assemble to form a trans-SNARE complex, an extended, parallel four alpha-helical bundle that drives membrane fusion. SNAP29 is a SNARE involved in autophagy through the direct control of autophagosome membrane fusion with the lysososome membrane. Plays also a role in ciliogenesis by regulating membrane fusions.

Involvement in disease : Cerebral dysgenesis, neuropathy, ichthyosis, and palmoplantar keratoderma syndrome (CEDNIK)

Subcellular location : Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic vesicle, autophagosome membrane, Peripheral membrane protein, Cell projection, cilium membrane, Peripheral membrane protein

Protein Families : SNAP-25 family

Tissue Specificity : Found in brain, heart, kidney, liver, lung, placenta, skeletal muscle, spleen and pancreas.

Paythway : Autophagy-animal

Uniprot ID : O95721