Recombinant Human Syndecan-4 (SDC4), partial

Product Description

Recombinant Human Syndecan-4 (SDC4), partial is available at Gentaur for Next week Delivery.

Gene Name: SDC4

Alternative Names : Amphiglycan Ryudocan core protein

Expression Region : 19-145aa

AA Sequence : ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 29.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Cell surface proteoglycan that bears heparan sulfate.

Function : Cell surface proteoglycan that bears heparan sulfate. Regulates exosome biogenesis in concert with SDCBP and PDCD6IP

Involvement in disease :

Subcellular location : Isoform 1: Membrane, Single-pass type I membrane protein, Secreted

Protein Families : Syndecan proteoglycan family

Tissue Specificity : Expressed in epithelial and fibroblastic cells.

Paythway :

Uniprot ID : P31431