Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L)

Product Description

Recombinant Human TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65KDA subunit 5L (TAF5L) is available at Gentaur for Next week Delivery.

Gene Name: TAF5L

Alternative Names : PCAF-associated factor 65 beta

Expression Region : 1-325aa

AA Sequence : MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal GST-tagged

Theoretical MW : 64 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.

Function : Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : WD repeat TAF5 family

Tissue Specificity :

Paythway :

Uniprot ID : O75529