Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1), partial

Product Description

Recombinant Human TeRatocarcinoma-derived growth factor 1 (TDGF1), partial is available at Gentaur for Next week Delivery.

Gene Name: TDGF1

Alternative Names : Cripto-1 growth factor;CRGFEpidermal growth factor-like cripto protein CR1

Expression Region : 32-150aa

AA Sequence : GHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCD

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Developmental Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Could play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.

Function : GPI-anchored cell membrane protein involved in Nodal signaling. Cell-associated TDGF1 acts as a Nodal coreceptor in cis. Shedding of TDGF1 by TMEM8A modulates Nodal signaling by allowing soluble TDGF1 to act as a Nodal coreceptor on other cells

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor, Secreted

Protein Families : EGF-CFC (Cripto-1/FRL1/Cryptic) family

Tissue Specificity : Preferentially expressed in gastric and colorectal carcinomas than in their normal counterparts. Expressed in breast and lung.

Paythway :

Uniprot ID : P13385