Recombinant Human Testisin (PRSS21)

Product Description

Recombinant Human Testisin (PRSS21) is available at Gentaur for Next week Delivery.

Gene Name: PRSS21

Alternative Names : Eosinophil serine protease 1

Expression Region : 42-288aa

AA Sequence : IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Could regulate proteolytic events associated with testicular germ cell maturation.

Function : Could regulate proteolytic events associated with testicular germ cell maturation.

Involvement in disease :

Subcellular location : Cell membrane, Lipid-anchor, GPI-anchor

Protein Families : Peptidase S1 family

Tissue Specificity : Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.

Paythway :

Uniprot ID : Q9Y6M0