Product Description
Recombinant Human Thiopurine S-methyltransferase (TPMT), partial is available at Gentaur for Next week Delivery.
Gene Name: TPMT
Alternative Names : Thiopurine methyltransferase
Expression Region : 4-244aa
AA Sequence : TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 54.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Metabolism
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
Function : Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Class I-like SAM-binding methyltransferase superfamily, TPMT family
Tissue Specificity :
Paythway :
Uniprot ID : P51580
Euro
British Pound
US Dollar