Recombinant Human Thiopurine S-methyltransferase (TPMT), partial

Product Description

Recombinant Human Thiopurine S-methyltransferase (TPMT), partial is available at Gentaur for Next week Delivery.

Gene Name: TPMT

Alternative Names : Thiopurine methyltransferase

Expression Region : 4-244aa

AA Sequence : TRTSLDIEEYSDTEVQKNQVLTLEEWQDKWVNGKTAFHQEQGHQLLKKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIWDRGALVAINPGDRKCYADTMFSLLGKKFQYLLCVLSYDPTKHPGPPFYVPHAEIERLFGKICNIRCLEKVDAFEERHKSWGIDCLFEKLYLLTE

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 54.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.

Function : Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Class I-like SAM-binding methyltransferase superfamily, TPMT family

Tissue Specificity :

Paythway :

Uniprot ID : P51580