Recombinant Human Thioredoxin domain-containing protein 17 (TXNDC17)

Product Description

Recombinant Human Thioredoxin domain-containing protein 17 (TXNDC17) is available at Gentaur for Next week Delivery.

Gene Name: TXNDC17

Alternative Names : 14KDA thioredoxin-related protein;TRP14Protein 42-9-9Thioredoxin-like protein 5

Expression Region : 1-123aa

AA Sequence : MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSED

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 40.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.

Function : Disulfide reductase. May participate in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyze dithiol-disulfide exchange reactions. Modulates TNF-alpha signaling and NF-kappa-B activation. Has peroxidase activity and may contribute to the elimination of cellular hydrogen peroxide.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Thioredoxin family

Tissue Specificity : Ubiquitously expressed in cell lines.

Paythway :

Uniprot ID : Q9BRA2