Recombinant Human Thioredoxin (TXN) (Active)

Product Description

Recombinant Human Thioredoxin (TXN) (Active) is available at Gentaur for Next week Delivery.

Gene Name: TXN

Alternative Names : Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1

Expression Region : 1-105aa

AA Sequence : MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 13.9 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.2

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : Specific activity as determined by the production of urea during the hydrolysis of arginine is greater than 0.1 Abs/min/mg.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thioredoxin (TXN) is a member of the Thioredoxin family. Thioredoxin exists as a disulfide-linked homodimer and contains one Thioredoxin domain. Thioredoxin is up-regulated by ionizing radiation. Thioredoxin participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Thioredoxin also plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide.

Function : Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.; FUNCTION

Involvement in disease :

Subcellular location : Nucleus, Cytoplasm, Secreted

Protein Families : Thioredoxin family

Tissue Specificity :

Paythway : NOD-likereceptorsignalingpathway

Uniprot ID : P10599