Recombinant Human Threonine--tRNA ligase, mitochondrial (TARS2), partial

Product Description

Recombinant Human Threonine--tRNA ligase, mitochondrial (TARS2), partial is available at Gentaur for Next week Delivery.

Gene Name: TARS2

Alternative Names : Threonyl-tRNA synthetase;ThrRSThreonyl-tRNA synthetase-like 1

Expression Region : 369-718aa

AA Sequence : EHYQEDMFAVQPPGSDRPPSSQSDDSTRHITDTLALKPMNCPAHCLMFAHRPRSWRELPLRLADFGALHRAEASGGLGGLTRLRCFQQDDAHIFCTTDQLEAEIQSCLDFLRSVYAVLGFSFRLALSTRPSGFLGDPCLWDQAEQVLKQALKEFGEPWDLNSGDGAFYGPKIDVHLHDALGRPHQCGTIQLDFQLPLRFDLQYKGQAGALERPVLIHRAVLGSVERLLGVLAESCGGKWPLWLSPFQVVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLPEAVQRLVELQNTRVPNAEEIF

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 55.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Catalyzes the attachment of threonine to tRNA(Thr) in a two-step reaction

Involvement in disease : Combined oxidative phosphorylation deficiency 21 (COXPD21)

Subcellular location : Mitochondrion matrix

Protein Families : Class-II aminoacyl-tRNA synthetase family

Tissue Specificity :

Paythway :

Uniprot ID : Q9BW92