Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3)

Product Description

Recombinant Human Transcription cofactor vestigial-like protein 3 (VGLL3) is available at Gentaur for Next week Delivery.

Gene Name: VGLL3

Alternative Names :

Expression Region : 1-320aa

AA Sequence : MSCAEVMYHPQPYGASQYLPNPMAATTCPTAYYQPAPQPGQQKKLAVFSKMQDSLEVTLPSKQEEEDEEEEEEEKDQPAEMEYLNSRCVLFTYFQGDIGSVVDEHFSRALGQAITLHPESAISKSKMGLTPLWRDSSALSSQRNSFPTSFWTSSYQPPPAPCLGGVHPDFQVTGPPGTFSAADPSPWPGHNLHQTGPAPPPAVSESWPYPLTSQVSPSYSHMHDVYMRHHHPHAHMHHRHRHHHHHHHPPAGSALDPSYGPLLMPSVHAARIPAPQCDITKTEPTTVTSATSAWAGAFHGTVDIVPSVGFDTGWSAMARS

Sequence Info : Full Length of Isoform 2

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May act as a specific coactivator for the mammalian TEFs.

Function : May act as a specific coactivator for the mammalian TEFs.

Involvement in disease :

Subcellular location : Nucleus

Protein Families : Vestigial family

Tissue Specificity : Enriched in placenta.

Paythway :

Uniprot ID : A8MV65