Recombinant Human Transgelin (TAGLN)

Product Description

Recombinant Human Transgelin (TAGLN) is available at Gentaur for Next week Delivery.

Gene Name: TAGLN

Alternative Names : 22KDA actin-binding protein;Protein WS3-10Smooth muscle protein 22-alpha;SM22-alpha

Expression Region : 2-201aa

AA Sequence : ANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 49.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Actin cross-linking/gelling protein . Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Function : Actin cross-linking/gelling protein (By similarity). Involved in calcium interactions and contractile properties of the cell that may contribute to replicative senescence.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Calponin family

Tissue Specificity :

Paythway :

Uniprot ID : Q01995