Recombinant Human Translation initiation factor eIF-2B subunit alpha (EIF2B1)

Product Description

Recombinant Human Translation initiation factor eIF-2B subunit alpha (EIF2B1) is available at Gentaur for Next week Delivery.

Gene Name: EIF2B1

Alternative Names : eIF-2B GDP-GTP exchange factor subunit alpha

Expression Region : 1-305aa

AA Sequence : MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 60.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

Function : Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.

Involvement in disease : Leukodystrophy with vanishing white matter (VWM)

Subcellular location :

Protein Families : EIF-2B alpha/beta/delta subunits family

Tissue Specificity :

Paythway :

Uniprot ID : Q14232