Product Description
Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial is available at Gentaur for Next week Delivery.
Gene Name: TM4SF1
Alternative Names : Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6
Expression Region : 115-161aa
AA Sequence : LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 7.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : L6 tetraspanin family
Tissue Specificity : Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular.
Paythway :
Uniprot ID : P30408
 Euro
 Euro
             British Pound
 British Pound
             US Dollar
 US Dollar
             
             
                 
       
           
           
           
           
          