Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial

Product Description

Recombinant Human Transmembrane 4 L6 family member 1 (TM4SF1), partial is available at Gentaur for Next week Delivery.

Gene Name: TM4SF1

Alternative Names : Membrane component chromosome 3 surface marker 1 Tumor-associated antigen L6

Expression Region : 115-161aa

AA Sequence : LAEGPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 7.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Membrane, Multi-pass membrane protein

Protein Families : L6 tetraspanin family

Tissue Specificity : Highly expressed in lung, breast, colon and ovarian carcinomas. It is also present on some normal cells, endothelial cells in particular.

Paythway :

Uniprot ID : P30408