Recombinant Human Transmembrane protein 132A (TMEM132A), partial

Product Description

Recombinant Human Transmembrane protein 132A (TMEM132A), partial is available at Gentaur for Next week Delivery.

Gene Name: TMEM132A

Alternative Names : HSPA5-binding protein 1 HSPA5BP1, KIAA1583

Expression Region : 642-742aa

AA Sequence : QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL

Sequence Info : Partial

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 17.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation

Function : May play a role in embryonic and postnatal development of the brain. Increased resistance to cell death induced by serum starvation in cultured cells. Regulates cAMP-induced GFAP gene expression via STAT3 phosphorylation (By similarity).

Involvement in disease :

Subcellular location : Golgi apparatus membrane, Single-pass type I membrane protein, Endoplasmic reticulum membrane, Single-pass type I membrane protein

Protein Families : TMEM132 family

Tissue Specificity :

Paythway :

Uniprot ID : Q24JP5