Product Description
Recombinant Human Transmembrane protein 14B (TMEM14B) is available at Gentaur for Next week Delivery.
Gene Name: TMEM14B
Alternative Names :
Expression Region : 1-114aa
AA Sequence : MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 39.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location : Membrane, Multi-pass membrane protein
Protein Families : TMEM14 family
Tissue Specificity : Mainly expressed in the outer subventricular zone (OSVZ) of the fetal brains.
Paythway :
Uniprot ID : Q9NUH8