Recombinant Human Trefoil factor 3 (TFF3), partial

Product Description

Recombinant Human Trefoil factor 3 (TFF3), partial is available at Gentaur for Next week Delivery.

Gene Name: TFF3

Alternative Names : Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

Expression Region : 29-80aa

AA Sequence : LLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGV

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 7.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Function : Involved in the maintenance and repair of the intestinal mucosa. Promotes the mobility of epithelial cells in healing processes (motogen).

Involvement in disease :

Subcellular location : Secreted, extracellular space, extracellular matrix, Cytoplasm

Protein Families :

Tissue Specificity : Expressed in goblet cells of the intestines and colon (at protein level). Expressed by goblet cells of small and large intestinal epithelia and also by the uterus. Also expressed in the hypothalamus where it is detected in paraventricular, periventricular and supraoptic nuclei (at protein level).

Paythway :

Uniprot ID : Q07654