Recombinant Human Tricarboxylate transport protein (SLC20A3), partial

Product Description

Recombinant Human Tricarboxylate transport protein (SLC20A3), partial is available at Gentaur for Next week Delivery.

Gene Name: SLC20A3

Alternative Names : Citrate transport protein;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein

Expression Region : 47-87aa

AA Sequence : EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 31.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.

Function : Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.

Involvement in disease : Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)

Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein

Protein Families : Mitochondrial carrier (TC 2.A.29) family

Tissue Specificity :

Paythway :

Uniprot ID : P53007