Product Description
Recombinant Human Tricarboxylate transport protein (SLC20A3), partial is available at Gentaur for Next week Delivery.
Gene Name: SLC20A3
Alternative Names : Citrate transport protein;CTPSolute carrier family 25 member 1Tricarboxylate carrier protein
Expression Region : 47-87aa
AA Sequence : EYVKTQLQLDERSHPPRYRGIGDCVRQTVRSHGVLGLYRGL
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 31.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Transport
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in citrate-H+/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD+ for the glycolytic pathway.
Function : Involved in citrate-H(+)/malate exchange. Important for the bioenergetics of hepatic cells as it provides a carbon source for fatty acid and sterol biosyntheses, and NAD(+) for the glycolytic pathway.
Involvement in disease : Combined D-2- and L-2-hydroxyglutaric aciduria (D2L2AD)
Subcellular location : Mitochondrion inner membrane, Multi-pass membrane protein
Protein Families : Mitochondrial carrier (TC 2.A.29) family
Tissue Specificity :
Paythway :
Uniprot ID : P53007
Euro
British Pound
US Dollar