Recombinant Human Trifunctional enzyme subunit beta, mitochondrial (HADHB), partial

Product Description

Recombinant Human Trifunctional enzyme subunit beta, mitochondrial (HADHB), partial is available at Gentaur for Next week Delivery.

Gene Name: HADHB

Alternative Names : TP-beta 1 domains:3-ketoacyl-CoA thiolase (EC:2.3.1.16);Acetyl-CoA acyltrans feraseBeta-ketothiolase

Expression Region : 35-283aa

AA Sequence : APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 53.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease : Mitochondrial trifunctional protein deficiency (MTPD)

Subcellular location : Mitochondrion, Mitochondrion inner membrane, Mitochondrion outer membrane, Endoplasmic reticulum

Protein Families : Thiolase family

Tissue Specificity :

Paythway :

Uniprot ID : P55084