Recombinant Human tRNA methyltransferase 112 homolog (TRMT112)

Product Description

Recombinant Human tRNA methyltransferase 112 homolog (TRMT112) is available at Gentaur for Next week Delivery.

Gene Name: TRMT112

Alternative Names : tRNA methyltransferase 112 homolog

Expression Region : 1-125aa

AA Sequence : MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 30.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Metabolism

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Participates both in methylation of protein and tRNA species. The heterodimer with HK2/N6AMT1 catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. The heterodimer with ALKBH8 catalyzes the methylation of 5-carboxymethyl uridine to 5-methylcarboxymethyl uridine at the wobble position of the anticodon loop in target tRNA species.

Function : Acts as an activator of both rRNA/tRNA and protein methyltransferases

Involvement in disease :

Subcellular location : Nucleus, nucleoplasm, Cytoplasm, perinuclear region

Protein Families : TRM112 family

Tissue Specificity :

Paythway :

Uniprot ID : Q9UI30