Product Description
Recombinant Human Troponin C, skeletal muscle (TNNC2) is available at Gentaur for Next week Delivery.
Gene Name: TNNC2
Alternative Names :
Expression Region : 1-160aa
AA Sequence : TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 45 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.
Function : Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components
Involvement in disease :
Subcellular location :
Protein Families : Troponin C family
Tissue Specificity :
Paythway : Calciumsignalingpathway
Uniprot ID : P02585
Euro
British Pound
US Dollar