Recombinant Human Troponin C, skeletal muscle (TNNC2)

Product Description

Recombinant Human Troponin C, skeletal muscle (TNNC2) is available at Gentaur for Next week Delivery.

Gene Name: TNNC2

Alternative Names :

Expression Region : 1-160aa

AA Sequence : TDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components: Tn-I which is the inhibitor of actomyosin ATPase, Tn-T which contains the binding site for tropomyosin and Tn-C. The binding of calcium to Tn-C abolishes the inhibitory action of Tn on actin filaments.

Function : Troponin is the central regulatory protein of striated muscle contraction. Tn consists of three components

Involvement in disease :

Subcellular location :

Protein Families : Troponin C family

Tissue Specificity :

Paythway : Calciumsignalingpathway

Uniprot ID : P02585