Euro
British Pound
US Dollar
Product Description
Recombinant Human Trypsin-3 (PRSS3), partial is available at Gentaur for Next week Delivery.
Gene Name: PRSS3
Alternative Names : Brain trypsinogen;Mesotrypsinogen;Serine protease 3Serine protease 4Trypsin IIITrypsin IV
Expression Region : 81-303aa
AA Sequence : IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 28.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.
Function : Digestive protease specialized for the degradation of trypsin inhibitors. In the ileum, may be involved in defensin processing, including DEFA5.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Peptidase S1 family
Tissue Specificity : Expressed in pancreas and brain. Also expressed in Paneth cells, at the base of small intestinal crypts.
Paythway :
Uniprot ID : P35030
