Euro
British Pound
US Dollar
Product Description
Recombinant Human Tubulin beta-3 chain (TUBB3), partial is available at Gentaur for Next week Delivery.
Gene Name: TUBB3
Alternative Names : Tubulin beta-4 chain;Tubulin beta-III
Expression Region : 1-210aa
AA Sequence : MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDI
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 50.1 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
Function : Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
Involvement in disease : Fibrosis of extraocular muscles, congenital, 3A (CFEOM3A); Cortical dysplasia, complex, with other brain malformations 1 (CDCBM1)
Subcellular location : Cytoplasm, cytoskeleton
Protein Families : Tubulin family
Tissue Specificity : Expression is primarily restricted to central and peripheral nervous system. Greatly increased expression in most cancerous tissues.
Paythway : Gapjunction
Uniprot ID : Q13509
