Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial (Active)

Product Description

Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: TNFSF4

Alternative Names : Tumor necrosis factor ligand superfamily member 4;Glycoprotein Gp34;OX40 ligand;OX40L;TAX transcriptionally-activated glycoprotein 1;TNFSF4;CD252;TXGP1

Expression Region : 51-183aa

AA Sequence : QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.3 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to bind Human OX40 in functional ELISA is less than 20 ug/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein.OX40L is expressed on the surface of activated B cells, T cells, dendritic cells and endothelial cells. OX40L binds to OX40 (CD134), a member of the TNF receptor superfamily that is expressed predominantly on activated CD4+ T cells. OX40-OX40L co-stimulates signal to promote the survival and proliferation of activated CD4+ T cells and prolong the immune response. It involved in T-cell proliferation and cytokine production. Additional, it has been found association with systemic lupus erythematosus, no association with occurrence of atherosclerosis.

Function : Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.

Involvement in disease : Systemic lupus erythematosus (SLE)

Subcellular location : Membrane, Single-pass type II membrane protein

Protein Families : Tumor necrosis factor family

Tissue Specificity :

Paythway :

Uniprot ID : P23510