Product Description
Recombinant Human Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial (Active) is available at Gentaur for Next week Delivery.
Gene Name: TNFSF4
Alternative Names : Tumor necrosis factor ligand superfamily member 4;Glycoprotein Gp34;OX40 ligand;OX40L;TAX transcriptionally-activated glycoprotein 1;TNFSF4;CD252;TXGP1
Expression Region : 51-183aa
AA Sequence : QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Sequence Info : Extracellular Domain
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 16.3 kDa
Storage Buffer : Lyophilized from a 0.2 ?m filtered 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-
Biological Activity : The ED50 as determined by its ability to bind Human OX40 in functional ELISA is less than 20 ug/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein.OX40L is expressed on the surface of activated B cells, T cells, dendritic cells and endothelial cells. OX40L binds to OX40 (CD134), a member of the TNF receptor superfamily that is expressed predominantly on activated CD4+ T cells. OX40-OX40L co-stimulates signal to promote the survival and proliferation of activated CD4+ T cells and prolong the immune response. It involved in T-cell proliferation and cytokine production. Additional, it has been found association with systemic lupus erythematosus, no association with occurrence of atherosclerosis.
Function : Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Involvement in disease : Systemic lupus erythematosus (SLE)
Subcellular location : Membrane, Single-pass type II membrane protein
Protein Families : Tumor necrosis factor family
Tissue Specificity :
Paythway :
Uniprot ID : P23510
Euro
British Pound
US Dollar