Euro
British Pound
US Dollar
Product Description
Recombinant Human Tumor necrosis factor receptor superfamily member 11A (TNFRSF11A), partial is available at Gentaur for Next week Delivery.
Gene Name: TNFRSF11A
Alternative Names : Osteoclast differentiation factor receptor;ODFRReceptor activator of NF-KB; CD265
Expression Region : 28-202aa
AA Sequence : LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 23.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Immunology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Function : Receptor for TNFSF11/RANKL/TRANCE/OPGL; essential for RANKL-mediated osteoclastogenesis. Involved in the regulation of interactions between T-cells and dendritic cells.
Involvement in disease : Familial expansile osteolysis (FEO); Paget disease of bone 2, early-onset (PDB2); Osteopetrosis, autosomal recessive 7 (OPTB7)
Subcellular location : Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform RANK-e5a: Cell membrane, Single-pass type I membrane protein
Protein Families :
Tissue Specificity : Ubiquitous expression with high levels in skeletal muscle, thymus, liver, colon, small intestine and adrenal gland.
Paythway : NF-kappaBsignalingpathway
Uniprot ID : Q9Y6Q6
