Product Description
Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial is available at Gentaur for Next week Delivery.
Gene Name: RELT
Alternative Names : Receptor expressed in lymphoid tissues
Expression Region : 26-153aa
AA Sequence : STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 17.7 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Mediates activation of NF-kappa-B. May play a role in T-cell activation.
Function : Mediates activation of NF-kappa-B. May play a role in T-cell activation.
Involvement in disease :
Subcellular location : Cell membrane, Single-pass type I membrane protein, Cytoplasm
Protein Families : RELT family
Tissue Specificity : Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.
Paythway :
Uniprot ID : Q969Z4
Euro
British Pound
US Dollar