Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial

Product Description

Recombinant Human Tumor necrosis factor receptor superfamily member 19L protein (RELT), partial is available at Gentaur for Next week Delivery.

Gene Name: RELT

Alternative Names : Receptor expressed in lymphoid tissues

Expression Region : 26-153aa

AA Sequence : STTLWQCPPGEEPDLDPGQGTLCRPCPPGTFSAAWGSSPCQPHARCSLWRRLEAQVGMATRDTLCGDCWPGWFGPWGVPRVPCQPCSWAPLGTHGCDEWGRRARRGVEVAAGASSGGETRQPGNGTRA

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 17.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Mediates activation of NF-kappa-B. May play a role in T-cell activation.

Function : Mediates activation of NF-kappa-B. May play a role in T-cell activation.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, Cytoplasm

Protein Families : RELT family

Tissue Specificity : Highest levels are in spleen, lymph node, thymus, peripheral blood leukocytes, bone marrow and fetal liver. Very low levels in skeletal muscle, testis and colon. Not detected in brain, kidney and pancreas.

Paythway :

Uniprot ID : Q969Z4