Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active)

Product Description

Recombinant Human Tumor necrosis factor receptor superfamily member 1A (TNFRSF1A), partial (Active) is available at Gentaur for Next week Delivery.

Gene Name: TNFRSF1A

Alternative Names : Tumor necrosis factor receptor superfamily member 1A;Tumor necrosis factor receptor 1;TNF-R1;Tumor necrosis factor receptor type I;TNF-RI;TNFR-I;TNFAR; TNFR1

Expression Region : 22-211aa

AA Sequence : IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 23.5 kDa

Storage Buffer : Lyophilized from a 0.2 ?m filtered 1xPBS, pH 7.4

Endotoxin Level : Less than 1.0 EU/µg as determined by LAL method.-

Biological Activity : The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L?929 mouse fibroblast cells is less than 500 ng/ml in the presence of the metabolic inhibitor actinomycin D. 

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cancer

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Tumor necrosis factor receptor superfamily member 1A (Tnfrsf1a) is a member of the tumor necrosis factor receptor superfamily. Tnfrsf1a is one of the major receptors for the tumor necrosis factor-alpha. It can activate the transcription factor NF-?B, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the human genetic disorder called tumor necrosis factor associated periodic syndrome (TRAPS) or periodic fever syndrome

Function : Receptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.

Involvement in disease : Familial hibernian fever (FHF); Multiple sclerosis 5 (MS5)

Subcellular location : Cell membrane, Single-pass type I membrane protein, Golgi apparatus membrane, Single-pass type I membrane protein, Secreted, Note=A secreted form is produced through proteolytic processing, SUBCELLULAR LOCATION: Isoform 4: Secreted

Protein Families :

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : P19438