Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial

Product Description

Recombinant Human Tyrosine-protein phosphatase non-receptor type 5 (PTPN5), partial is available at Gentaur for Next week Delivery.

Gene Name: PTPN5

Alternative Names : Neural-specific protein-tyrosine phosphatase;Striatum-enriched protein-tyrosine phosphatase;STEP

Expression Region : 300-555aa

AA Sequence : LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 45.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Function : May regulate the activity of several effector molecules involved in synaptic plasticity and neuronal cell survival, including MAPKs, Src family kinases and NMDA receptors.

Involvement in disease :

Subcellular location : Endoplasmic reticulum membrane, Multi-pass membrane protein

Protein Families : Protein-tyrosine phosphatase family, Non-receptor class subfamily

Tissue Specificity :

Paythway : MAPKsignalingpathway

Uniprot ID : P54829