Euro
British Pound
US Dollar
Product Description
Recombinant Human U2 small nuclear ribonucleoprotein B (SNRPB2) is available at Gentaur for Next week Delivery.
Gene Name: SNRPB2
Alternative Names :
Expression Region : 1-225aa
AA Sequence : MDIRPNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFVIFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKMRGTFADKEKKKEKKKAKTVEQTATTTNKKPGQGTPNSANTQGNSTPNPQVPDYPPNYILFLNNLPEETNEMMLSMLFNQFPGFKEVRLVPGRHDIAFVEFENDGQAGAARDALQGFKITPSHAMKITYAKK
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 41.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds st loop IV of U2 snRNA only in presence of the U2A' protein.
Function : Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.
Involvement in disease :
Subcellular location : Nucleus
Protein Families : RRM U1 A/B'' family
Tissue Specificity :
Paythway :
Uniprot ID : P08579
