Product Description
Recombinant Human Ubiquitin-conjugating enzyme E2 D4 (UBE2D4) is available at Gentaur for Next week Delivery.
Gene Name: UBE2D4
Alternative Names : E2 ubiquitin-conjugating enzyme D4 HBUCE1 Ubiquitin carrier protein D4 Ubiquitin-protein ligase D4
Expression Region : 1-147aa
AA Sequence : MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 43.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.
Function : Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.
Involvement in disease :
Subcellular location :
Protein Families : Ubiquitin-conjugating enzyme family
Tissue Specificity :
Paythway : Proteinprocessinginendoplasmicreticulum
Uniprot ID : Q9Y2X8
Euro
British Pound
US Dollar